DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and igsf9b

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:250 Identity:50/250 - (20%)
Similarity:85/250 - (34%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWM-------RKRDLHILTTNIYT 100
            |.|:....|.|....|..:..::.|...|.|........|:.|.       ::.::.:|...   
Zfish   133 NFLSITAPPVFIKTPPPFLEVLLGESLTLHCDAHGNPKPTIIWRKYLSAAEKQEEIQVLNET--- 194

  Fly   101 YTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQV-NTEPKINLAICLQV-------IADNDF 157
                               |.:.......:|:|:|.| |:|..:..:..|||       ||..| 
Zfish   195 -------------------LSLSKVTRETAGIYKCHVSNSEGNLTHSTQLQVKGPPIIIIAPED- 239

  Fly   158 QDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVI----WYHGSSVVDFDSLR 218
                                  |.:::.:|:  .|.|....: ||.:    |..|.:|...:.|:
Zfish   240 ----------------------TTMNMSQDA--VLQCQAEAY-PSNLTYEWWKQGQNVYHIEILK 279

  Fly   219 GGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVP-NGAIPASVRVHVLTGEQPA 272
            ..:.:..:.|       |:::.....|||||||.| ||.:........||.:.||
Zfish   280 SRVKILVDGT-------LLISALIPDDSGNYTCRPTNGLMTPPAASAYLTVKHPA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 14/96 (15%)
IG_like 58..140 CDD:214653 13/89 (15%)
IG_like 179..265 CDD:214653 22/90 (24%)
Ig 187..257 CDD:299845 21/74 (28%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845
IG_like 148..227 CDD:214653 15/100 (15%)
IGc2 156..217 CDD:197706 12/82 (15%)
Ig 237..323 CDD:299845 24/118 (20%)
IG_like 237..323 CDD:214653 24/118 (20%)
Ig 345..411 CDD:143165
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.