DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:296 Identity:62/296 - (20%)
Similarity:105/296 - (35%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRK 88
            :|:|.:|...:|.|  .|....|...:      .|.:.:.|..:.|:|.|.:.|... .|.|.:.
Human     1 MLSLLVWILTLSDT--FSQGTQTRFSQ------EPADQTVVAGQRAVLPCVLLNYSG-IVQWTKD 56

  Fly    89 RDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIA 153
            .....:...:..:   .|:.|:....:..::|:|..|:..|...||||. ||..:          
Human    57 GLALGMGQGLKAW---PRYRVVGSADAGQYNLEITDAELSDDASYECQA-TEAAL---------- 107

  Fly   154 DNDFQDLKTKKRFYDTKSARAKIL-----------GSTEIHVKRDSTIALAC-SVNIH-APSVIW 205
                            :|.|||:.           |...|.::..:...|.| :.|.. |.::||
Human   108 ----------------RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIW 156

  Fly   206 YHG-----SSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTC-VPNGAIPA----- 259
            :..     .:|...:.|:.| ..||      |.|:|::....|.....:|| ..|.|||:     
Human   157 FRDGTQQEGAVASTELLKDG-KRET------TVSQLLINPTDLDIGRVFTCRSMNEAIPSGKETS 214

  Fly   260 -SVRVH----VLTGEQPAAMQTSSAIRIRAFTAMIT 290
             .:.||    |....:|..:|....:   .||...|
Human   215 IELDVHHPPTVTLSIEPQTVQEGERV---VFTCQAT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 20/88 (23%)
IG_like 58..140 CDD:214653 18/81 (22%)
IG_like 179..265 CDD:214653 24/103 (23%)
Ig 187..257 CDD:299845 18/77 (23%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 24/130 (18%)
Ig 25..116 CDD:299845 24/127 (19%)
Ig2_KIRREL3-like 138..219 CDD:143236 21/87 (24%)
I-set 223..304 CDD:254352 6/28 (21%)
Ig_2 227..305 CDD:290606 5/24 (21%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.