DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and iglon5

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:326 Identity:63/326 - (19%)
Similarity:116/326 - (35%) Gaps:105/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKI 122
            |.|::.:..|..:|||::..:.... :|:.:.  :||.|....::.|.|.| :....:.|:.::|
Zfish    33 PDNITVLEGESVVLRCKIDEEVTHK-AWLNRS--NILFTGTDKWSLDSRVS-LENNNNSDFSIRI 93

  Fly   123 DYAQPRDSGVYEC--QVNTEPK----------------------------INLAICLQV------ 151
            :.....|.|.|.|  |...:|:                            :|| .||.|      
Zfish    94 ERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVNEGEDVNL-FCLAVGRPEPT 157

  Fly   152 ----------IADNDFQDLKTKKRFY---------------DTKSARAKI--------------- 176
                      :.:.:|.::...||..               ||:..:..:               
Zfish   158 ITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMPAQ 222

  Fly   177 LGSTEIHVKRDSTIALAC-SVNIHAPSVIWYHGS-SVVDFDSLRGGISLETEKTDVGTTSRLMLT 239
            :|.|.|         |.| ::.:...|..||... ..|:.|:.   :.::.||    |.|.|:.|
Zfish   223 VGKTAI---------LRCEAMAVPTASFEWYRDDRRPVESDNT---LKIKNEK----TRSLLLFT 271

  Fly   240 RASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYISSLM 304
            ..:.:..|||||..:..:.||....:|.  :|.|:...:|    :....::.:.....|.||.||
Zfish   272 NVTEKHFGNYTCFASNRLGASNASMLLF--RPGAVYGGAA----SLNGRLSGVGLWFCLSISVLM 330

  Fly   305 E 305
            :
Zfish   331 K 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 21/116 (18%)
IG_like 58..140 CDD:214653 20/83 (24%)
IG_like 179..265 CDD:214653 22/87 (25%)
Ig 187..257 CDD:299845 18/71 (25%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 21/93 (23%)
Ig 35..123 CDD:299845 20/91 (22%)
Ig 125..>183 CDD:299845 8/58 (14%)
I-set 128..207 CDD:254352 10/79 (13%)
IG_like 217..298 CDD:214653 23/96 (24%)
ig 223..296 CDD:278476 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.