Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017775.2 | Gene: | iglon5 / 550472 | ZFINID: | ZDB-GENE-050417-297 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 326 | Identity: | 63/326 - (19%) |
---|---|---|---|
Similarity: | 116/326 - (35%) | Gaps: | 105/326 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 PRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKI 122
Fly 123 DYAQPRDSGVYEC--QVNTEPK----------------------------INLAICLQV------ 151
Fly 152 ----------IADNDFQDLKTKKRFY---------------DTKSARAKI--------------- 176
Fly 177 LGSTEIHVKRDSTIALAC-SVNIHAPSVIWYHGS-SVVDFDSLRGGISLETEKTDVGTTSRLMLT 239
Fly 240 RASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYISSLM 304
Fly 305 E 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 21/116 (18%) |
IG_like | 58..140 | CDD:214653 | 20/83 (24%) | ||
IG_like | 179..265 | CDD:214653 | 22/87 (25%) | ||
Ig | 187..257 | CDD:299845 | 18/71 (25%) | ||
iglon5 | NP_001017775.2 | IG_like | 33..123 | CDD:214653 | 21/93 (23%) |
Ig | 35..123 | CDD:299845 | 20/91 (22%) | ||
Ig | 125..>183 | CDD:299845 | 8/58 (14%) | ||
I-set | 128..207 | CDD:254352 | 10/79 (13%) | ||
IG_like | 217..298 | CDD:214653 | 23/96 (24%) | ||
ig | 223..296 | CDD:278476 | 23/88 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |