DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Ntm

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:225 Identity:53/225 - (23%)
Similarity:85/225 - (37%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFS-----VIHPPGSEDWD 119
            ||:....|.|.|||.:.|:..| |:|:.:..:        .|.|:.::.     |:.......:.
  Rat    44 NVTVRQGESATLRCTIDNRVTR-VAWLNRSTI--------LYAGNDKWCLDPRVVLLSNTQTQYS 99

  Fly   120 LKIDYAQPRDSGVYECQVNTE--PKIN-LAICLQVIADNDFQDLKTKKRFYDTKSARAKILG-ST 180
            ::|......|.|.|.|.|.|:  ||.: :.:.:||                     ..||:. |:
  Rat   100 IEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQV---------------------SPKIVEISS 143

  Fly   181 EIHVKRDSTIALAC-SVNIHAPSVIWYHGS-SVVDFDSLRGGISLETEKTDVGTTSRLMLTRASL 243
            :|.:...:.|:|.| :.....|:|.|.|.| ..|.|.|       |.|..::...:|        
  Rat   144 DISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVS-------EDEYLEIQGITR-------- 193

  Fly   244 RDSGNYTCVPNGAIPASV--RVHVLTGEQP 271
            ..||.|.|..:..:.|.|  ||.|.....|
  Rat   194 EQSGEYECSASNDVAAPVVRRVKVTVNYPP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 23/92 (25%)
Ig 184..267 CDD:472250 23/86 (27%)
Ig strand B 190..194 CDD:409353 2/3 (67%)
Ig strand C 202..206 CDD:409353 1/3 (33%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 2/4 (50%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 23/96 (24%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 2/4 (50%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 0/2 (0%)
Ig_3 136..205 CDD:464046 22/83 (27%)
Ig 223..307 CDD:472250 1/1 (100%)
Ig strand B 239..243 CDD:409408
Ig strand C 252..256 CDD:409408
Ig strand E 278..282 CDD:409408
Ig strand F 292..297 CDD:409408
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.