DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr12

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:301 Identity:99/301 - (32%)
Similarity:151/301 - (50%) Gaps:45/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VLNLNIWCQY-----ISATSYLSLNDLTNLERPFFDD--ISPRNVSAVVDEIAILRCRVKNKGN- 80
            :|..|.|.:.     |:..|.|. |:|.:.:.|.|:|  :...|.:..:...|.|.|:|..... 
  Fly    44 ILTDNDWKKLWMRGGINGDSKLD-NNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRV 107

  Fly    81 ----RTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEP 141
                ..:||:|:||.|||::....||.|:||:::|.|||..|.|:|.:.|.||.|:|||||:|..
  Fly   108 GVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPT 172

  Fly   142 K-INLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPS--- 202
            . |:..:.|||:....|                  ||||.|:||...|||.|.|.:. .:|:   
  Fly   173 GIISHFVNLQVVVPEAF------------------ILGSGELHVDMGSTINLVCIIE-KSPTPPQ 218

  Fly   203 -VIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL 266
             |.|.....::::...|..|::|| .....|.|||::....:.|||||||..:...|||:.|.|.
  Fly   219 YVYWQKNDRLINYVDSRRDITIET-TPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVS 282

  Fly   267 TGEQPAAM---QTSSAIRI----RAFTAMITIISTKVLLYI 300
            .|:..||:   :||||.|:    |:..|...:::|.|:.:|
  Fly   283 KGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 36/94 (38%)
IG_like 58..140 CDD:214653 34/86 (40%)
IG_like 179..265 CDD:214653 31/89 (35%)
Ig 187..257 CDD:299845 23/73 (32%)
dpr12NP_652462.3 IG 86..183 CDD:214652 37/96 (39%)
Ig_3 193..271 CDD:404760 27/79 (34%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.