DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and OPCML

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:354 Identity:68/354 - (19%)
Similarity:117/354 - (33%) Gaps:147/354 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSV-------IHPPGSED 117
            ||:....|.|.|||.:.::..| |:|:.:..:        .|.|:.::|:       ::.|  ..
Human    44 NVTVRQGESATLRCTIDDRVTR-VAWLNRSTI--------LYAGNDKWSIDPRVIILVNTP--TQ 97

  Fly   118 WDLKIDYAQPRDSGVYECQVNTE--PKIN-LAICLQVIADNDFQDLKTKKRFYDTKSARAKILG- 178
            :.:.|......|.|.|.|.|.|:  ||.: :.:.:||                     ..:|:. 
Human    98 YSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQV---------------------PPQIMNI 141

  Fly   179 STEIHVKRDSTIALAC-SVNIHAPSVIWYH-----GSSVVDFDSL-------------------- 217
            |::|.|...|::.|.| ::....|:|.|.|     |...|..|..                    
Human   142 SSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALN 206

  Fly   218 --------------------------------RGGISLET------------EKT---------- 228
                                            :|.:|.|.            |:|          
Human   207 DVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMR 271

  Fly   229 --DVGTTSRLMLTRASLRDSGNYTCVPN---GAIPASVRVHVLTGEQ----PAAM--QTSSAIRI 282
              :.|..|.|.....|.:|.||||||..   |...||:.::.::...    |.|:  ..:||.|.
Human   272 IENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGPGAVIDGVNSASRA 336

  Fly   283 RAFTAMITIISTKVLLYIS-SLMEHMYLR 310
            .|            .|::| :|:.|.:::
Human   337 LA------------CLWLSGTLLAHFFIK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 23/94 (24%)
Ig 184..267 CDD:472250 30/167 (18%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 1/3 (33%)
Ig strand E 234..238 CDD:409353 2/3 (67%)
Ig strand G 261..264 CDD:409353 0/2 (0%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 23/98 (23%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 2/4 (50%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 14/70 (20%)
Ig 224..312 CDD:472250 19/87 (22%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.