Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229536.1 | Gene: | NCAM1 / 4684 | HGNCID: | 7656 | Length: | 884 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 52/225 - (23%) |
---|---|---|---|
Similarity: | 83/225 - (36%) | Gaps: | 67/225 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 IWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKG-NRTVSWMRKRDLH 92
Fly 93 ILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQV------NTEPKINLAICLQV 151
Fly 152 IADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACS-VNIHAPSVIWYH-GSSVV-- 212
Fly 213 ----------DFDSLRGGISLETEKTDVGT 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 25/95 (26%) |
IG_like | 58..140 | CDD:214653 | 23/88 (26%) | ||
IG_like | 179..265 | CDD:214653 | 15/68 (22%) | ||
Ig | 187..257 | CDD:299845 | 15/60 (25%) | ||
NCAM1 | NP_001229536.1 | Ig1_NCAM-1 | 20..115 | CDD:143273 | 28/112 (25%) |
IG | 124..190 | CDD:214652 | 18/86 (21%) | ||
Ig | 211..307 | CDD:325142 | |||
Ig | 306..438 | CDD:325142 | |||
Ig_3 | 447..519 | CDD:316449 | |||
FN3 | 534..631 | CDD:238020 | |||
fn3 | 639..720 | CDD:306538 | |||
Trypan_PARP | <792..>864 | CDD:330686 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |