DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and NCAM1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:225 Identity:52/225 - (23%)
Similarity:83/225 - (36%) Gaps:67/225 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKG-NRTVSWMRKRDLH 92
            ||..:...|: :||.          .||.|......|.|.....|:|.... ::.:||..... .
Human     8 IWTLFFLGTA-VSLQ----------VDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNG-E 60

  Fly    93 ILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQV------NTEPKINLAICLQV 151
            .||.|      .||.||:....|.. .|.|..|...|:|:|:|.|      .:|..:|:.|..::
Human    61 KLTPN------QQRISVVWNDDSSS-TLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKL 118

  Fly   152 IADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACS-VNIHAPSVIWYH-GSSVV-- 212
            :    |::..|.:.|.:.:.|                  .:.|. |:...|::||.| |..|:  
Human   119 M----FKNAPTPQEFREGEDA------------------VIVCDVVSSLPPTIIWKHKGRDVILK 161

  Fly   213 ----------DFDSLRGGISLETEKTDVGT 232
                      ::..:||     .:|||.||
Human   162 KDVRFIVLSNNYLQIRG-----IKKTDEGT 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 25/95 (26%)
IG_like 58..140 CDD:214653 23/88 (26%)
IG_like 179..265 CDD:214653 15/68 (22%)
Ig 187..257 CDD:299845 15/60 (25%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 28/112 (25%)
IG 124..190 CDD:214652 18/86 (21%)
Ig 211..307 CDD:325142
Ig 306..438 CDD:325142
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.