DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and negr1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:237 Identity:57/237 - (24%)
Similarity:95/237 - (40%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPRNVSAVVDEIAILRCRVK---NKGNRTVSWMRKRDLHILTTNIYT----YTGDQRFSVIHPPG 114
            |..:|.:...:.|:|||.:.   :||    :|:.:..:      ||.    ::||.|.|::...|
Zfish    43 SSESVVSRQGDTALLRCYLLDGISKG----AWLNRSSI------IYAGNDKWSGDPRVSIVSNVG 97

  Fly   115 SE-DWDLKIDYAQPRDSGVYECQVNTE----PKINLAICLQVIADNDFQDLKTKKRFYDTKSARA 174
            .: ::.|:|......|.|||.|.:.:|    ||:     :|:|       :|...:.||.     
Zfish    98 DKHEYSLQIQKVDVTDEGVYTCSIQSERNLHPKL-----IQLI-------VKVPPKIYDI----- 145

  Fly   175 KILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLML 238
                |::|.|...|.::|.|:.: ...|.:.|.|             ||....|.:.|  ..|.:
Zfish   146 ----SSDITVNEGSNVSLICAASGKPEPKISWRH-------------ISPSARKYESG--EYLNI 191

  Fly   239 TRASLRDSGNYTCVPNG--AIPASVRVHVLTGEQPAAMQTSS 278
            |..|...:|:|.|....  |.|.:..|.|.....||..:..|
Zfish   192 TGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 26/99 (26%)
IG_like 58..140 CDD:214653 22/89 (25%)
IG_like 179..265 CDD:214653 22/88 (25%)
Ig 187..257 CDD:299845 16/72 (22%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 23/87 (26%)
IG_like 44..136 CDD:214653 27/113 (24%)
I-set 140..222 CDD:254352 25/105 (24%)
IGc2 153..208 CDD:197706 16/69 (23%)
IG_like 236..312 CDD:214653
IGc2 238..304 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.