DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr5

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:274 Identity:106/274 - (38%)
Similarity:154/274 - (56%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YISATSYLS--LNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILT 95
            :::|...||  :.|..:...|.||:.:.|.|.|.:...|.|.|||::.|:|.|||:|:|||||||
  Fly    70 HLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILT 134

  Fly    96 TNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDL 160
            ..|.|||.||||...|...|::|.|||...|.||:|||||||:|||||:||..|.|:        
  Fly   135 IGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVV-------- 191

  Fly   161 KTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPS----VIWYHGSSVVDFDSLRGGI 221
                      :::|:||.:.|:.::..|.|.|.| :...||.    ::|:..:.:|. ||.||||
  Fly   192 ----------TSKAQILANRELFIQSGSDINLTC-IAPQAPGPYTHMLWHKDTELVS-DSARGGI 244

  Fly   222 SLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFT 286
            .:|:|:.  ..||.|:::|....|||||||..:.:...||.||::..||.||||.....|:  ..
  Fly   245 RVESEQQ--MKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRL--LL 305

  Fly   287 AMITIISTKVLLYI 300
            ..:.::...|||.:
  Fly   306 PPLPLLLLAVLLVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 50/88 (57%)
IG_like 58..140 CDD:214653 45/81 (56%)
IG_like 179..265 CDD:214653 31/89 (35%)
Ig 187..257 CDD:299845 27/73 (37%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 53/95 (56%)
IG_like 98..179 CDD:214653 45/80 (56%)
IG_like 206..278 CDD:214653 27/75 (36%)
Ig 211..278 CDD:143165 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.