DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Ama

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:330 Identity:76/330 - (23%)
Similarity:118/330 - (35%) Gaps:100/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR 87
            |::.| |:|..||..|.||        .|....||...|::|.|.:. ..|.|:..|..:|||.:
  Fly    14 LLIGL-IFCLAISLDSVLS--------APVISQISKDVVASVGDSVE-FNCTVEEVGQLSVSWAK 68

  Fly    88 K------RDLHILTTNIYTYTGDQRFSVI----HPPGSEDWDLKIDYAQPRDSGVYECQ--VNTE 140
            :      ..:.:...||.:.. |||::|.    ...||..:..:|...:..|.|.||||  |:..
  Fly    69 RPSESDTNSVVLSMRNILSLP-DQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSAT 132

  Fly   141 PKINLAICLQ-----VIADN--------DFQDLK------------------------------- 161
            .|:...:.||     |||:|        :.|:|:                               
  Fly   133 EKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLA 197

  Fly   162 ------------TKKRFY----------DTKSARAKILGSTEIHVKR-------DSTIALACSVN 197
                        .:..:|          |.:..|.::....:|.|:|       ..:..|.|||.
  Fly   198 EPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQ 262

  Fly   198 IH-APSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTC-VPNGAIPAS 260
            .: ||:|:|:...  |...|.|......|..:...|||.|.:......|.|:|.| ..|....|.
  Fly   263 GYPAPTVVWHKNG--VPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHAD 325

  Fly   261 VRVHV 265
            .|:|:
  Fly   326 ARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 28/100 (28%)
IG_like 58..140 CDD:214653 25/93 (27%)
IG_like 179..265 CDD:214653 26/94 (28%)
Ig 187..257 CDD:299845 21/71 (30%)
AmaNP_731114.2 I-set 33..143 CDD:254352 30/111 (27%)
Ig 37..127 CDD:299845 25/91 (27%)
IG_like 154..234 CDD:214653 5/79 (6%)
IGc2 161..223 CDD:197706 3/61 (5%)
I-set 254..330 CDD:254352 23/77 (30%)
IGc2 254..322 CDD:197706 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.