Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
Alignment Length: | 330 | Identity: | 76/330 - (23%) |
---|---|---|---|
Similarity: | 118/330 - (35%) | Gaps: | 100/330 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR 87
Fly 88 K------RDLHILTTNIYTYTGDQRFSVI----HPPGSEDWDLKIDYAQPRDSGVYECQ--VNTE 140
Fly 141 PKINLAICLQ-----VIADN--------DFQDLK------------------------------- 161
Fly 162 ------------TKKRFY----------DTKSARAKILGSTEIHVKR-------DSTIALACSVN 197
Fly 198 IH-APSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTC-VPNGAIPAS 260
Fly 261 VRVHV 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 28/100 (28%) |
IG_like | 58..140 | CDD:214653 | 25/93 (27%) | ||
IG_like | 179..265 | CDD:214653 | 26/94 (28%) | ||
Ig | 187..257 | CDD:299845 | 21/71 (30%) | ||
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 30/111 (27%) |
Ig | 37..127 | CDD:299845 | 25/91 (27%) | ||
IG_like | 154..234 | CDD:214653 | 5/79 (6%) | ||
IGc2 | 161..223 | CDD:197706 | 3/61 (5%) | ||
I-set | 254..330 | CDD:254352 | 23/77 (30%) | ||
IGc2 | 254..322 | CDD:197706 | 21/69 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |