DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr11

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:285 Identity:98/285 - (34%)
Similarity:146/285 - (51%) Gaps:40/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SATSYLSLNDLTN-------------LERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWM 86
            |||::.||..:::             |..|:.|..:..||:..:...|.|.||||..||::|||:
  Fly    88 SATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWI 152

  Fly    87 RKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQV 151
            |.||.||||.:...:..||||..|..| .:.|.|:|.|.|.||:|.|||||:||||::..:.|||
  Fly   153 RLRDGHILTVDRAVFIADQRFLAIKQP-DKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQV 216

  Fly   152 IADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN--IHAPS-VIWYHGSSVVD 213
            :.                  .|.:|||..:.:||..|.:.|.|.|.  :..|: ::||||:..:.
  Fly   217 VV------------------PRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLA 263

  Fly   214 FDSLRGGISLETEKTDV-----GTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAA 273
            .||.|....|:....:.     .|...|::..|..||:|||||.|:.:..|:|.::::.||..|:
  Fly   264 ADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSAS 328

  Fly   274 MQTSSAIRIRAFTAMITIISTKVLL 298
            ..||||...||:...|..:...|:|
  Fly   329 AVTSSAATTRAYALSILALLLSVIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 43/88 (49%)
IG_like 58..140 CDD:214653 39/81 (48%)
IG_like 179..265 CDD:214653 28/93 (30%)
Ig 187..257 CDD:299845 24/77 (31%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 44/91 (48%)
Ig 127..217 CDD:299845 44/90 (49%)
IG_like 227..320 CDD:214653 28/92 (30%)
IGc2 234..311 CDD:197706 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.