| Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
| Alignment Length: | 289 | Identity: | 63/289 - (21%) |
|---|---|---|---|
| Similarity: | 108/289 - (37%) | Gaps: | 80/289 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 LNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDI-----SPRNVSAVVDEIA 69
Fly 70 I-------LRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQP 127
Fly 128 RDSGVYEC----QVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDS 188
Fly 189 TIALACSVNIHAPSVI-WYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTC- 251
Fly 252 VPN--GAIPASVRVHVLTGEQPAAMQTSS 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 21/104 (20%) |
| IG_like | 58..140 | CDD:214653 | 20/92 (22%) | ||
| IG_like | 179..265 | CDD:214653 | 24/89 (27%) | ||
| Ig | 187..257 | CDD:299845 | 20/73 (27%) | ||
| IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 8/49 (16%) |
| Ig strand A' | 41..46 | CDD:409353 | |||
| Ig strand B | 48..56 | CDD:409353 | |||
| CDR1 | 56..60 | CDD:409353 | |||
| FR2 | 61..68 | CDD:409353 | |||
| Ig strand C | 61..67 | CDD:409353 | |||
| CDR2 | 69..79 | CDD:409353 | |||
| Ig strand C' | 71..74 | CDD:409353 | |||
| Ig strand C' | 76..79 | CDD:409353 | |||
| FR3 | 80..115 | CDD:409353 | 7/29 (24%) | ||
| Ig strand D | 84..91 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 94..100 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 107..115 | CDD:409353 | 1/7 (14%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/9 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
| Ig_3 | 134..199 | CDD:404760 | 17/85 (20%) | ||
| Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 162..170 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 191..199 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 202..212 | CDD:409353 | 3/14 (21%) | ||
| Ig_3 | 217..295 | CDD:404760 | 25/97 (26%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/10 (20%) | ||
| Ig strand B | 234..238 | CDD:409353 | 1/12 (8%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) | ||
| Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||