DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and IGLON5

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:289 Identity:63/289 - (21%)
Similarity:108/289 - (37%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDI-----SPRNVSAVVDEIA 69
            |.|:|   :.|.||:..:.:..:.:...|:.:.:      :|:...:     .|..:..:...:.
Human    88 LINTP---EEFSILITEVGLGDEGLYTCSFQTRH------QPYTTQVYLIVHVPARIVNISSPVT 143

  Fly    70 I-------LRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQP 127
            :       |.|....:...||:|.:.||         .:|            ||...|:|...|.
Human   144 VNEGGNVNLLCLAVGRPEPTVTWRQLRD---------GFT------------SEGEILEISDIQR 187

  Fly   128 RDSGVYEC----QVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDS 188
            ..:|.|||    .||:.|...     :|:...::....|     |..|||. .||...:      
Human   188 GQAGEYECVTHNGVNSAPDSR-----RVLVTVNYPPTIT-----DVTSART-ALGRAAL------ 235

  Fly   189 TIALACSVNIHAPSVI-WYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTC- 251
               |.|......|:.. ||....::...:.. |:.::||:    |.|.|:....|.|..||||| 
Human   236 ---LRCEAMAVPPADFQWYKDDRLLSSGTAE-GLKVQTER----TRSMLLFANVSARHYGNYTCR 292

  Fly   252 VPN--GAIPASVRVHVLTGEQPAAMQTSS 278
            ..|  ||..||:|:     .:|.:::.|:
Human   293 AANRLGASSASMRL-----LRPGSLENSA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 21/104 (20%)
Ig 184..267 CDD:472250 24/86 (28%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 0/4 (0%)
Ig strand E 234..238 CDD:409353 2/3 (67%)
Ig strand G 261..264 CDD:409353 1/2 (50%)
IGLON5NP_001094842.1 Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 17/85 (20%)
Ig_3 217..295 CDD:464046 25/97 (26%)
Ig 41..129 CDD:472250 8/49 (16%)
Ig strand B 50..54 CDD:409382
Ig strand C 62..66 CDD:409382
Ig strand E 95..99 CDD:409382 2/3 (67%)
Ig strand F 109..114 CDD:409382 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.