DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and TMIGD1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:294 Identity:52/294 - (17%)
Similarity:111/294 - (37%) Gaps:92/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVS 84
            |::||:   ::......:|.|::|..|   ..:..|.:|.:.::::       |.|:|       
Human    14 FLLLVI---LFLPREMTSSVLTVNGKT---ENYILDTTPGSQASLI-------CAVQN------- 58

  Fly    85 WMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLK-----------IDYAQPRDSGV-YECQV 137
                   |.....:..|..:.|.           |||           :......|:|: :.|::
Human    59 -------HTREEELLWYREEGRV-----------DLKSGNKINSSSVCVSSISENDNGISFTCRL 105

  Fly   138 NTEPKINLAICLQV-----IADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN 197
            ..:..:::::.|.|     ::.||||.                        |:..|.:.|.|:|.
Human   106 GRDQSVSVSVVLNVTFPPLLSGNDFQT------------------------VEEGSNVKLVCNVK 146

  Fly   198 IHAPS-VIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPA-S 260
            .:..: ::||..||::|.:..|..|...:|      :.:|.:|:....|:|.|:|:...::.. |
Human   147 ANPQAQMMWYKNSSLLDLEKSRHQIQQTSE------SFQLSITKVEKPDNGTYSCIAKSSLKTES 205

  Fly   261 VRVHVLTGEQPAAMQTSSAIRIRAFTAMITIIST 294
            :..|::..::...:.....|     .|.:.|..|
Human   206 LDFHLIVKDKTVGVPIEPII-----AACVVIFLT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 13/100 (13%)
IG_like 58..140 CDD:214653 13/93 (14%)
IG_like 179..265 CDD:214653 20/87 (23%)
Ig 187..257 CDD:299845 18/70 (26%)
TMIGD1NP_996663.1 IG 131..212 CDD:214652 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1099491at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.