DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Tmigd1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001128501.1 Gene:Tmigd1 / 363654 RGDID:1307444 Length:261 Species:Rattus norvegicus


Alignment Length:253 Identity:48/253 - (18%)
Similarity:95/253 - (37%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AILRCRVKN-KGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGV 132
            |.|.|.|:| ..:..:.|.|:.....|.......|.    ||...|.:|.           |:||
  Rat    49 ASLECAVQNHTRDEELLWYREAGRVDLKNGNKINTS----SVCVSPINES-----------DNGV 98

  Fly   133 -YECQVNTEPKINLAICLQV-----IADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIA 191
             :.|::..:..:::.:.|.|     ::.|.||.                        |:..|.:.
  Rat    99 SFTCKLQRDQTVSITVVLNVTFPPLLSGNGFQT------------------------VEEGSDVR 139

  Fly   192 LACSVNIHAPS-VIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNG 255
            |.|:|..:..: ::||..:|.:..:..|..|....|      :.:|.:||....|:|.|.|:.:.
  Rat   140 LVCNVKSNPQAQMLWYRNNSALVLEKGRHQIQQTRE------SFQLSITRVKKSDNGTYNCIASS 198

  Fly   256 AIPA-SVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYISSLMEHMYLRER 312
            ::.. ::..|::..::...|...            .||:..|:::::.....:..|||
  Rat   199 SLKTETMDFHLVVKDKVPVMPIE------------PIIAACVVVFLTLAFALLSRRER 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 17/77 (22%)
IG_like 58..140 CDD:214653 17/72 (24%)
IG_like 179..265 CDD:214653 18/87 (21%)
Ig 187..257 CDD:299845 17/70 (24%)
Tmigd1NP_001128501.1 IG_like 130..211 CDD:214653 20/110 (18%)
Ig strand B 138..142 CDD:409353 1/3 (33%)
Ig strand C 151..155 CDD:409353 0/3 (0%)
Ig strand E 177..181 CDD:409353 1/3 (33%)
Ig strand F 191..196 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1099491at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.