| Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
| Alignment Length: | 228 | Identity: | 49/228 - (21%) |
|---|---|---|---|
| Similarity: | 90/228 - (39%) | Gaps: | 63/228 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 VSAVVDEIAILRCRVKNKGNR-----TVSWMRKRDLHILTTN---IYTYTG------DQRFSVIH 111
Fly 112 PPGSEDWDLKIDYAQPRDSGVYECQV--NTEPKINLAICLQ-----VIADNDFQDLKTKKRFYDT 169
Fly 170 KSARAKILGSTEIHVKRDSTIALACSVNIH-APSVIWYHGSSVVDFDSLRGGISLETEK-TDVGT 232
Fly 233 TSRLMLTRASLRDSGNYTCVPNGAIPASVRVHV 265 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 26/99 (26%) |
| IG_like | 58..140 | CDD:214653 | 24/94 (26%) | ||
| IG_like | 179..265 | CDD:214653 | 17/87 (20%) | ||
| Ig | 187..257 | CDD:299845 | 16/71 (23%) | ||
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/100 (26%) |
| FR1 | 37..50 | CDD:409353 | 3/18 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 2/10 (20%) | ||
| Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 12/30 (40%) | ||
| Ig strand D | 84..90 | CDD:409353 | 3/5 (60%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 134..208 | CDD:404760 | 21/107 (20%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | |||
| Ig strand C | 256..260 | CDD:409353 | |||
| Ig strand E | 286..290 | CDD:409353 | |||
| Ig strand F | 300..305 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||