DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and DIP-zeta

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:97/250 - (38%) Gaps:56/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD 90
            ||||..:....|.|:.     |:..|     :.|||.        |.|.|||.|:..|:||....
  Fly   105 NLNIVVEEPEFTEYIE-----NVTVP-----AGRNVK--------LGCSVKNLGSYKVAWMHFEQ 151

  Fly    91 LHILTTNIYTYTGDQRFSVIHPPGS--EDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIA 153
            ..|||.:.:..|.:.|.||.|....  ..|.|.|:.....|.|.|.||:||.........|.|:.
  Fly   152 SAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV 216

  Fly   154 DNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGSSVVDFDSL 217
            ..:..|                .|.|:::.|:..:.|:|.|..: ...|.:.|...      |:.
  Fly   217 PPNIDD----------------SLSSSDVIVREGANISLRCRASGSPRPIIKWKRD------DNS 259

  Fly   218 RGGISLETEKTDV-----GTTSRLMLTRASLRDSGNYTCVPNGAIPASV--RVHV 265
            |..|:    |..:     |.|  |.:||.|..|.|.|.|:.:..:|.:|  |:.|
  Fly   260 RIAIN----KNHIVNEWEGDT--LEITRISRLDMGAYLCIASNGVPPTVSKRIKV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 30/90 (33%)
Ig 184..267 CDD:472250 23/89 (26%)
Ig strand B 190..194 CDD:409353 2/3 (67%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 2/4 (50%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 34/113 (30%)
Ig strand B 130..134 CDD:409405 2/11 (18%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 26/118 (22%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 1/1 (100%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 2/7 (29%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 2/6 (33%)
IG_like 325..410 CDD:214653
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.