DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:97/250 - (38%) Gaps:56/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD 90
            ||||..:....|.|:.     |:..|     :.|||.        |.|.|||.|:..|:||....
  Fly   105 NLNIVVEEPEFTEYIE-----NVTVP-----AGRNVK--------LGCSVKNLGSYKVAWMHFEQ 151

  Fly    91 LHILTTNIYTYTGDQRFSVIHPPGS--EDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIA 153
            ..|||.:.:..|.:.|.||.|....  ..|.|.|:.....|.|.|.||:||.........|.|:.
  Fly   152 SAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV 216

  Fly   154 DNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGSSVVDFDSL 217
            ..:..|                .|.|:::.|:..:.|:|.|..: ...|.:.|...      |:.
  Fly   217 PPNIDD----------------SLSSSDVIVREGANISLRCRASGSPRPIIKWKRD------DNS 259

  Fly   218 RGGISLETEKTDV-----GTTSRLMLTRASLRDSGNYTCVPNGAIPASV--RVHV 265
            |..|:    |..:     |.|  |.:||.|..|.|.|.|:.:..:|.:|  |:.|
  Fly   260 RIAIN----KNHIVNEWEGDT--LEITRISRLDMGAYLCIASNGVPPTVSKRIKV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 30/90 (33%)
IG_like 58..140 CDD:214653 29/83 (35%)
IG_like 179..265 CDD:214653 24/93 (26%)
Ig 187..257 CDD:299845 19/75 (25%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 34/113 (30%)
Ig 130..200 CDD:143165 25/77 (32%)
I-set 226..310 CDD:254352 24/94 (26%)
IGc2 233..298 CDD:197706 19/76 (25%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.