DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and DIP-iota

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:99/245 - (40%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NIWCQYISAT--SYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD 90
            :.|...:.:.  |..|.::|.|.:..|...|:  |.:..|...|:|.|.|.:..:..|:|:|...
  Fly     7 SFWLLLLQSVCFSQASFSELNNSDPKFSGPIN--NSTVPVGRDALLTCVVHDLVSFKVAWLRVDT 69

  Fly    91 LHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADN 155
            ..||:...:..|.:.|.|:.|.. ...|.|||...|..|.|.|.||:||:|..:....|.|:...
  Fly    70 QTILSIQNHVITKNHRISISHTE-HRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPP 133

  Fly   156 DFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACS-VNIHAPSVIWYHGSS---VVDFDS 216
            |..|.:|.:          .::.||      ...:.|.|| ..:..|::.|....:   ::..|.
  Fly   134 DIVDYQTSQ----------DVVRST------GQNVTLTCSATGVPMPTITWRREEATPILISDDG 182

  Fly   217 LRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL 266
            .|...|:|.:        .|.|.:......|.|.|:.:..:|.:|...|:
  Fly   183 DREVFSVEGQ--------NLTLWQVQRSHMGAYLCIASNGVPPTVSKRVM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 29/88 (33%)
Ig 184..267 CDD:472250 17/87 (20%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 1/2 (50%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/86 (33%)
Ig strand B 48..52 CDD:143290 2/3 (67%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 22/116 (19%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 0/3 (0%)
Ig strand E 192..196 CDD:409562 1/11 (9%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.