DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:99/245 - (40%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NIWCQYISAT--SYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD 90
            :.|...:.:.  |..|.::|.|.:..|...|:  |.:..|...|:|.|.|.:..:..|:|:|...
  Fly     7 SFWLLLLQSVCFSQASFSELNNSDPKFSGPIN--NSTVPVGRDALLTCVVHDLVSFKVAWLRVDT 69

  Fly    91 LHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADN 155
            ..||:...:..|.:.|.|:.|.. ...|.|||...|..|.|.|.||:||:|..:....|.|:...
  Fly    70 QTILSIQNHVITKNHRISISHTE-HRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPP 133

  Fly   156 DFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACS-VNIHAPSVIWYHGSS---VVDFDS 216
            |..|.:|.:          .::.||      ...:.|.|| ..:..|::.|....:   ::..|.
  Fly   134 DIVDYQTSQ----------DVVRST------GQNVTLTCSATGVPMPTITWRREEATPILISDDG 182

  Fly   217 LRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL 266
            .|...|:|.:        .|.|.:......|.|.|:.:..:|.:|...|:
  Fly   183 DREVFSVEGQ--------NLTLWQVQRSHMGAYLCIASNGVPPTVSKRVM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 29/88 (33%)
IG_like 58..140 CDD:214653 26/81 (32%)
IG_like 179..265 CDD:214653 18/89 (20%)
Ig 187..257 CDD:299845 14/73 (19%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/86 (33%)
Ig 39..122 CDD:299845 28/83 (34%)
Ig 132..213 CDD:299845 19/104 (18%)
IG_like 141..227 CDD:214653 19/108 (18%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.