DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr4

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:266 Identity:117/266 - (43%)
Similarity:168/266 - (63%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVI 110
            |...:|:||:.|.|.|:|.|.:.|:|.|||:|.|:|.|||:|||||||||..|.|||.||||..:
  Fly    40 TPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSL 104

  Fly   111 HPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAK 175
            |..||::|.|:|...||||||.|||||:|||||:....|.|:.                  :|||
  Fly   105 HSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV------------------SRAK 151

  Fly   176 ILGSTEIHVKRDSTIALACSVNIHAP----SVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRL 236
            |||:.|:.:|..|.|.|.| :.:.:|    .:.||.|..|::: |.||||::.||::.  .||:|
  Fly   152 ILGNAELFIKSGSDINLTC-LAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVITERST--RTSKL 212

  Fly   237 MLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQ--TSSAIRIR--AFTAMITIISTKVL 297
            ::.:|:..|||||||.|:.:..|||.|||:.||.|||||  .|||..:|  :.|::..:::|.:.
  Fly   213 LIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMS 277

  Fly   298 LYISSL 303
            :.::|:
  Fly   278 MTVASV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 55/88 (63%)
IG_like 58..140 CDD:214653 49/81 (60%)
IG_like 179..265 CDD:214653 34/89 (38%)
Ig 187..257 CDD:299845 28/73 (38%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 55/92 (60%)
IG_like 53..145 CDD:214653 55/91 (60%)
ig 153..227 CDD:278476 29/77 (38%)
IG_like 161..>227 CDD:214653 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.