DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Opcml

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:310 Identity:59/310 - (19%)
Similarity:97/310 - (31%) Gaps:128/310 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSV-------IHPPGSED 117
            ||:....|.|.|||.:.::..| |:|:.:..:        .|.|:.::|:       ::.|  ..
Mouse    44 NVTVRQGESATLRCTIDDRVTR-VAWLNRSTI--------LYAGNDKWSIDPRVIILVNTP--TQ 97

  Fly   118 WDLKIDYAQPRDSGVYECQVNTE--PKIN-LAICLQVIADNDFQDLKTKKRFYDTKSARAKILG- 178
            :.:.|......|.|.|.|.|.|:  ||.: :.:.:||                     ..:|:. 
Mouse    98 YSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQV---------------------PPQIMNI 141

  Fly   179 STEIHVKRDSTIALAC-SVNIHAPSVIWYH-----GSSVVDFDSL-------------------- 217
            |::|.|...|::.|.| ::....|:|.|.|     |...|..|..                    
Mouse   142 SSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALN 206

  Fly   218 --------------------------------RGGISLETE----------KTDV---------- 230
                                            :|.:|.|..          |.|.          
Mouse   207 DVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVR 271

  Fly   231 ----GTTSRLMLTRASLRDSGNYTCVPN---GAIPASVRVHVLTGEQPAA 273
                |..|.|.....|.:|.||||||..   |...||:.::.::.....|
Mouse   272 IENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 23/94 (24%)
IG_like 58..140 CDD:214653 20/86 (23%)
IG_like 179..265 CDD:214653 32/170 (19%)
Ig 187..257 CDD:299845 27/154 (18%)
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 23/98 (23%)
Ig strand A' 44..49 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 5/7 (71%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 3/6 (50%)
Ig strand C 64..70 CDD:409353 3/6 (50%)
CDR2 71..83 CDD:409353 2/19 (11%)
Ig strand C' 72..76 CDD:409353 0/11 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 6/35 (17%)
Ig strand D 87..94 CDD:409353 0/6 (0%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 2/8 (25%)
FR4 125..132 CDD:409353 0/6 (0%)
Ig_3 135..206 CDD:404760 14/70 (20%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 2/4 (50%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 0/7 (0%)
Ig_3 223..300 CDD:404760 16/76 (21%)
putative Ig strand A 224..230 CDD:409353 0/5 (0%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.