DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr14

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:291 Identity:101/291 - (34%)
Similarity:152/291 - (52%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NIWCQYIS------ATSYLSLNDLTNLER-PFF-DDISPRNVSAVVDEIAILRCRVKNKGNRTVS 84
            |.|.::.|      ....|.:.:.|..|. ||| |..:..|:|..:.....|.|||.:...:|||
  Fly    43 NFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVS 107

  Fly    85 WMRKR--DLHILTTNIYTYTGDQRFSV-IHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLA 146
            |||:|  ||.::|...:||:||.|:|: ...|  .||.|.|.:|..||.|.|||||::.|.:.|.
  Fly   108 WMRRRGDDLTLITFGQHTYSGDSRYSLEFEEP--NDWKLLIQFANERDEGPYECQVSSHPPLVLL 170

  Fly   147 ICLQVIADN----DFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPS--VI 204
            :.|.:|..:    |.:...|.:::|                 |..|||.|.|.:: |..||  :.
  Fly   171 VYLTIIVPHVEILDERGSATPEKYY-----------------KAGSTIELQCVISKIPHPSSYIT 218

  Fly   205 WYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGE 269
            |.||..::::|:.|||||::|:.......|||.:..|:.:|:|||||:....|..:|.||||.||
  Fly   219 WRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGE 283

  Fly   270 QPAAMQTSSAIRIRAFTAMITIISTKVLLYI 300
            :|||||.::..|.:|..      ||.|:|::
  Fly   284 EPAAMQHANGSRQKANA------STMVVLFL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 37/91 (41%)
IG_like 58..140 CDD:214653 36/84 (43%)
IG_like 179..265 CDD:214653 32/88 (36%)
Ig 187..257 CDD:299845 28/72 (39%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 36/81 (44%)
Ig 84..169 CDD:299845 36/86 (42%)
IG_like 191..279 CDD:214653 33/104 (32%)
Ig 201..274 CDD:143165 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.