DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:353 Identity:75/353 - (21%)
Similarity:113/353 - (32%) Gaps:136/353 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CQYISATSYLSLNDLTNLERPFFDD---ISPRNVSAVVDEIAILRCRVKN-KGNRTVSWMRKRDL 91
            ||.|.|........||.|..|  ||   :....:|....:...|.|...| |...::.|:||.: 
  Rat   127 CQAIQAAIRSRPARLTVLVPP--DDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGE- 188

  Fly    92 HILTTNIYTYT---GDQRFSVIHP-----------------------PGSEDWDLKIDYAQPRDS 130
             ::....|:.|   ..:|.|::..                       ||.::..:.||...|   
  Rat   189 -VINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHP--- 249

  Fly   131 GVYECQVNTEPKINLAICLQ-VIADN------------DFQDLKTKKRFYDTKSARAKI------ 176
                      |.:||::..| |:.||            .....:..||.:..|.|..::      
  Rat   250 ----------PLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVD 304

  Fly   177 ---------------LGSTEIH-------------------VKRDSTIALACSVNIHAPS--VIW 205
                           ||||.:.                   |...|....:|:. |..||  ::|
  Rat   305 YTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAW-IGNPSLTIVW 368

  Fly   206 YHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLR--DSGNYTC---VPNGAIPASVRVHV 265
            ....|         |:.|..|||         ||..|:|  |:|.|.|   ||.  :.|..|...
  Rat   369 MKRGS---------GVVLSNEKT---------LTLKSVRQEDAGKYVCRAVVPR--VGAGEREVT 413

  Fly   266 LTGEQP---AAMQTSSAI-----RIRAF 285
            ||...|   ::.||..|:     :|:.|
  Rat   414 LTVNGPPIISSTQTQHALHGEKGQIKCF 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 18/115 (16%)
IG_like 58..140 CDD:214653 17/108 (16%)
IG_like 179..265 CDD:214653 27/111 (24%)
Ig 187..257 CDD:299845 22/76 (29%)
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 5/15 (33%)
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 16/98 (16%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 0/3 (0%)
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 0/4 (0%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 8/66 (12%)
Ig strand B 267..274 CDD:409353 0/6 (0%)
Ig strand C 279..286 CDD:409353 0/6 (0%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 3/12 (25%)
Ig 335..416 CDD:416386 26/101 (26%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/10 (20%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 4/14 (29%)
IgI_5_KIRREL3 418..515 CDD:409479 6/24 (25%)
Ig strand B 436..440 CDD:409479 1/3 (33%)
Ig strand C 450..454 CDD:409479
Ig strand E 481..485 CDD:409479
Ig strand F 496..501 CDD:409479
Ig strand G 509..512 CDD:409479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.