DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and kirre

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:301 Identity:63/301 - (20%)
Similarity:99/301 - (32%) Gaps:95/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNNSPIKIKPFIILVLNLNIWCQYI------------------------------SATSYLSLND 44
            :.:|.:.:.| :||||.|.:..|.|                              |.:|..:.:.
  Fly     4 MRSSRLLVLP-LILVLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAAASS 67

  Fly    45 LTNLERPFFDD-------ISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR-------KRDLHILT 95
            ..:..:|...|       :.|::.:|||.....|.|||..|.. .:.|.:       .|:|    
  Fly    68 ANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVG-ALQWTKDDFGLGQHRNL---- 127

  Fly    96 TNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDL 160
                  :|.:|:|::......|:.|.|......|...|:|||...|:....|             
  Fly   128 ------SGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGI------------- 173

  Fly   161 KTKKRFYD---------TKSARAKILGSTEIHVKRDSTIALACSVNIHAPS--VIWYHGSSVVDF 214
              :.||..         .|..:...|.:||     |..|.|.|......|:  :.|..|...|  
  Fly   174 --RSRFAKLTVLVPPEAPKITQGDYLVTTE-----DREIELECVSQGGKPAAEITWIDGLGNV-- 229

  Fly   215 DSLRGGISLETE--KTDVGTTSRLMLTRASLRDSGN--YTC 251
              |..||....|  ......|:|.:|..|..::..|  :||
  Fly   230 --LTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 24/95 (25%)
IG_like 58..140 CDD:214653 23/88 (26%)
IG_like 179..265 CDD:214653 21/79 (27%)
Ig 187..257 CDD:299845 19/71 (27%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 27/121 (22%)
IG_like 88..182 CDD:214653 27/119 (23%)
C2-set_2 189..279 CDD:285423 23/89 (26%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.