DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and rst

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:83/225 - (36%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR-------KRDLHILTTNIYTYTGDQRFSVIHPP 113
            :.|::.:|||.....|.|||.|| ..|:.|.:       .|||          :|.:|::::...
  Fly    32 MEPQDQTAVVGARVTLPCRVINK-QGTLQWTKDDFGLGTSRDL----------SGFERYAMVGSD 85

  Fly   114 GSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILG 178
            ...|:.|.|......|...|:|||:..|:...||      .:.|..|...     ......||..
  Fly    86 EEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAI------RSTFAGLTVL-----VPPEAPKITQ 139

  Fly   179 STEIHVKRDSTIALACSVNI---HAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR 240
            ...|:...|..:.:.| |::   .|..:.|..|...|..|::...:....::......|.|.||.
  Fly   140 GDVIYATEDRKVEIEC-VSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTP 203

  Fly   241 ASLRDSGNYTCVPNGAI-----PASVRVHV 265
            .....:.|::|......     .|.:||.|
  Fly   204 KKEHHNTNFSCQAQNTADRTYRSAKIRVEV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 26/95 (27%)
IG_like 58..140 CDD:214653 25/88 (28%)
IG_like 179..265 CDD:214653 18/93 (19%)
Ig 187..257 CDD:299845 14/72 (19%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 30/117 (26%)
Ig 42..114 CDD:299845 21/82 (26%)
C2-set_2 135..225 CDD:285423 17/90 (19%)
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.