DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:222 Identity:46/222 - (20%)
Similarity:79/222 - (35%) Gaps:62/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKI 122
            |.:.:.|....|:|.|.:.|... .|.|.:......:...:..:   .|:.|:....:..::|:|
  Rat    59 PADQTVVAGHRAVLPCVLLNYSG-IVQWTKDGLALGMGQGLKAW---PRYRVVGSADAGQYNLEI 119

  Fly   123 DYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKIL---------- 177
            ..|:..|...||||. ||..:                          :|.|||:.          
  Rat   120 TDAELSDDASYECQA-TEAAL--------------------------RSRRAKLTVLIPPEDTRI 157

  Fly   178 -GSTEIHVKRDSTIALAC-SVNIH-APSVIWYHG-----SSVVDFDSLRGGISLETEKTDVGTTS 234
             |...|.::..:...|.| :.|.. |.::||:..     .:|...:.|:.| ..||      |.|
  Rat   158 DGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDG-KRET------TIS 215

  Fly   235 RLMLTRASLRDSGNYTC------VPNG 255
            :|::....|.....:||      :|||
  Rat   216 QLLIQPTDLDIGRVFTCRSMNEAIPNG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 20/86 (23%)
IG_like 58..140 CDD:214653 18/81 (22%)
IG_like 179..265 CDD:214653 21/90 (23%)
Ig 187..257 CDD:299845 20/82 (24%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 24/119 (20%)
Ig 57..148 CDD:299845 24/119 (20%)
Ig2_KIRREL3-like 170..251 CDD:143236 20/80 (25%)
I-set 255..336 CDD:254352
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.