DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr9

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:232 Identity:96/232 - (41%)
Similarity:138/232 - (59%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PFFDDISPRNVSAVVDEIAILRCRVKNKGNRT----VSWMRKRDLHILTTNIYTYTGDQRFSVIH 111
            |:||....:||:|::.:.|.|.|||||.||:|    |||:|.||:|:||...||||.||||..||
  Fly   256 PYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIH 320

  Fly   112 PPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKI 176
            .|.:|||.|:|.|.|.||||:|||||:|.|.::..|.|.|:..:                  .:|
  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPS------------------TEI 367

  Fly   177 LGSTEIHVKRDSTIALACSVNIHAPS----VIWYHGSS------VVDFDSLRGGISLETEKTDVG 231
            :|:.:::::..|||.|.|.:. ::|.    :.|.|.::      ::::||.|||:|:.|.|.|. 
  Fly   368 IGAPDLYIESGSTINLTCIIQ-NSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDT- 430

  Fly   232 TTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTG 268
            |||.|::..|...|||:|.|.|:.|.|.||.||||.|
  Fly   431 TTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 51/92 (55%)
IG_like 58..140 CDD:214653 49/85 (58%)
IG_like 179..265 CDD:214653 33/95 (35%)
Ig 187..257 CDD:299845 28/79 (35%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 53/97 (55%)
IG_like 263..360 CDD:214653 53/96 (55%)
IG_like 371..464 CDD:214653 33/94 (35%)
IGc2 377..456 CDD:197706 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.