DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and dpr9

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:232 Identity:96/232 - (41%)
Similarity:138/232 - (59%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PFFDDISPRNVSAVVDEIAILRCRVKNKGNRT----VSWMRKRDLHILTTNIYTYTGDQRFSVIH 111
            |:||....:||:|::.:.|.|.|||||.||:|    |||:|.||:|:||...||||.||||..||
  Fly   256 PYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIH 320

  Fly   112 PPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKI 176
            .|.:|||.|:|.|.|.||||:|||||:|.|.::..|.|.|:..:                  .:|
  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPS------------------TEI 367

  Fly   177 LGSTEIHVKRDSTIALACSVNIHAPS----VIWYHGSS------VVDFDSLRGGISLETEKTDVG 231
            :|:.:::::..|||.|.|.:. ::|.    :.|.|.::      ::::||.|||:|:.|.|.|. 
  Fly   368 IGAPDLYIESGSTINLTCIIQ-NSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDT- 430

  Fly   232 TTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTG 268
            |||.|::..|...|||:|.|.|:.|.|.||.||||.|
  Fly   431 TTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 51/92 (55%)
Ig 184..267 CDD:472250 35/92 (38%)
Ig strand B 190..194 CDD:409353 2/3 (67%)
Ig strand C 202..206 CDD:409353 0/7 (0%)
Ig strand E 234..238 CDD:409353 2/3 (67%)
Ig strand G 261..264 CDD:409353 1/2 (50%)
dpr9NP_996215.1 IG_like 263..360 CDD:214653 53/96 (55%)
Ig strand B 274..278 CDD:409355 2/3 (67%)
Ig strand C 291..295 CDD:409355 2/3 (67%)
Ig strand E 327..331 CDD:409355 2/3 (67%)
Ig strand F 341..346 CDD:409355 3/4 (75%)
IG_like 371..464 CDD:214653 33/94 (35%)
Ig strand B 381..385 CDD:143220 2/3 (67%)
Ig strand C 396..400 CDD:143220 0/3 (0%)
Ig strand E 431..437 CDD:143220 4/5 (80%)
Ig strand F 447..452 CDD:143220 2/4 (50%)

Return to query results.
Submit another query.