DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and Lsamp

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:273 Identity:60/273 - (21%)
Similarity:100/273 - (36%) Gaps:101/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSE-------D 117
            |::....:.|||||.|::| |..|:|:.:..:        .:.|..::|:  .|..|       :
Mouse    71 NITVRQGDTAILRCVVEDK-NSKVAWLNRSGI--------IFAGHDKWSL--DPRVELEKRHALE 124

  Fly   118 WDLKIDYAQPRDSGVYECQVNTE---------------PKI-NLA-------------ICL---- 149
            :.|:|......|.|.|.|.|.|:               ||| |::             :|:    
Mouse   125 YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGR 189

  Fly   150 --QVIADNDFQDLKTKKRFYDTKSARAKILGST-----------------------EIHVKRDST 189
              .||.   ::.|....|.::.:....:|||.|                       ::.|....|
Mouse   190 PEPVIT---WRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPT 251

  Fly   190 I--------------ALACSVN-IHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLT 239
            |              :|.|..: :.||...||...:.:  :|..|   ||.:.|: |.:| |.:|
Mouse   252 ITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRI--NSANG---LEIKSTE-GQSS-LTVT 309

  Fly   240 RASLRDSGNYTCV 252
            ..:....||||||
Mouse   310 NVTEEHYGNYTCV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 26/107 (24%)
IG_like 58..140 CDD:214653 22/86 (26%)
IG_like 179..265 CDD:214653 25/112 (22%)
Ig 187..257 CDD:299845 23/81 (28%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 23/98 (23%)
Ig_3 163..232 CDD:372822 13/71 (18%)
Ig_3 250..325 CDD:372822 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.