Sequence 1: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766388.2 | Gene: | Sdk2 / 237979 | MGIID: | 2443847 | Length: | 2176 | Species: | Mus musculus |
Alignment Length: | 220 | Identity: | 46/220 - (20%) |
---|---|---|---|
Similarity: | 88/220 - (40%) | Gaps: | 40/220 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 ISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNI 98
Fly 99 YTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTK 163
Fly 164 KRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGSSVVDFDSLRGGISLETEK 227
Fly 228 TDVGTTSRLMLTRASLRDSGNYTCV 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 17/88 (19%) |
IG_like | 58..140 | CDD:214653 | 17/81 (21%) | ||
IG_like | 179..265 | CDD:214653 | 16/75 (21%) | ||
Ig | 187..257 | CDD:299845 | 15/67 (22%) | ||
Sdk2 | NP_766388.2 | IG_like | 44..113 | CDD:214653 | |
IGc2 | 44..102 | CDD:197706 | |||
IG_like | 124..207 | CDD:214653 | |||
Ig | 136..192 | CDD:299845 | |||
IG_like | 226..308 | CDD:214653 | 2/7 (29%) | ||
IGc2 | 237..290 | CDD:197706 | |||
I-set | 312..401 | CDD:254352 | 22/116 (19%) | ||
Ig | 330..398 | CDD:143165 | 18/95 (19%) | ||
I-set | 406..496 | CDD:254352 | 17/81 (21%) | ||
Ig | 420..496 | CDD:299845 | 15/67 (22%) | ||
Ig | 506..590 | CDD:299845 | |||
IG_like | 506..590 | CDD:214653 | |||
FN3 | 594..685 | CDD:238020 | |||
FN3 | 697..790 | CDD:238020 | |||
FN3 | 798..894 | CDD:238020 | |||
FN3 | 899..987 | CDD:238020 | |||
FN3 | 997..1091 | CDD:238020 | |||
FN3 | 1103..1198 | CDD:238020 | |||
FN3 | 1205..1294 | CDD:238020 | |||
FN3 | 1305..1398 | CDD:238020 | |||
FN3 | 1404..1488 | CDD:238020 | |||
FN3 | 1507..1620 | CDD:238020 | |||
FN3 | 1630..1723 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1712..1734 | ||||
FN3 | 1728..1809 | CDD:238020 | |||
FN3 | 1841..1920 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2013..2032 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2043..2070 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2102..2176 | ||||
PDZ-binding. /evidence=ECO:0000269|PubMed:20219992 | 2170..2176 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |