DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and zig-10

DIOPT Version :10

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:259 Identity:56/259 - (21%)
Similarity:93/259 - (35%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIH---PPGSEDWDLKIDY-----AQP 127
            |.|......|  |:|.  ||.|::.|     ....:.::::   |.|.|:...:|.:     .|.
 Worm    44 LECEPYTSSN--VTWY--RDKHVIAT-----VEGHKNAILNERKPRGGEERIPEIGFLVIFDVQK 99

  Fly   128 RDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTI-A 191
            .|.|.|.||...:.|......|::             .:.|..|...||        |.:..: .
 Worm   100 EDEGNYYCQRENDSKWGEV
FQLKI-------------AYVDEISQNEKI--------KLEPNVPT 143

  Fly   192 LACSVNIHA--------PSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGN 248
            |..|:.:|.        |.|.|...|..:..      ||.:......||   |:::..|....|.
 Worm   144 LGRSLVLHCPIPKAYPPPKVTWTVNSLPISH------ISSDYVAFPNGT---LIISHFSYHHFGY 199

  Fly   249 YTC-VPNGAIPASVRVHVLTGEQPAAMQT---------SSAIRIRAFTAMI--TIISTKVLLYI 300
            :.| :.|.|..||....:.:.|..|.:::         |:|:|...|..::  .|.|..||:|:
 Worm   200 FECNINNFAGHASTNTFIDSRELVANLESLKPTFVNGCSAALRSSLFMFLLGCLITSGAVLIYL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:462230 20/81 (25%)
Ig 184..267 CDD:472250 20/92 (22%)
Ig strand B 190..194 CDD:409353 1/4 (25%)
Ig strand C 202..206 CDD:409353 1/3 (33%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 0/2 (0%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 20/82 (24%)
Ig strand B 42..46 CDD:409353 1/1 (100%)
Ig strand C 53..57 CDD:409353 2/5 (40%)
Ig strand E 91..94 CDD:409353 0/2 (0%)
Ig strand F 104..109 CDD:409353 2/4 (50%)
Ig_3 134..206 CDD:464046 18/88 (20%)

Return to query results.
Submit another query.