DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and zig-10

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:259 Identity:56/259 - (21%)
Similarity:93/259 - (35%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIH---PPGSEDWDLKIDY-----AQP 127
            |.|......|  |:|.  ||.|::.|     ....:.::::   |.|.|:...:|.:     .|.
 Worm    44 LECEPYTSSN--VTWY--RDKHVIAT-----VEGHKNAILNERKPRGGEERIPEIGFLVIFDVQK 99

  Fly   128 RDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTI-A 191
            .|.|.|.||...:.|......|::             .:.|..|...||        |.:..: .
 Worm   100 EDEGNYYCQRENDSKWGEV
FQLKI-------------AYVDEISQNEKI--------KLEPNVPT 143

  Fly   192 LACSVNIHA--------PSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGN 248
            |..|:.:|.        |.|.|...|..:..      ||.:......||   |:::..|....|.
 Worm   144 LGRSLVLHCPIPKAYPPPKVTWTVNSLPISH------ISSDYVAFPNGT---LIISHFSYHHFGY 199

  Fly   249 YTC-VPNGAIPASVRVHVLTGEQPAAMQT---------SSAIRIRAFTAMI--TIISTKVLLYI 300
            :.| :.|.|..||....:.:.|..|.:::         |:|:|...|..::  .|.|..||:|:
 Worm   200 FECNINNFAGHASTNTFIDSRELVANLESLKPTFVNGCSAALRSSLFMFLLGCLITSGAVLIYL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 20/81 (25%)
IG_like 58..140 CDD:214653 19/76 (25%)
IG_like 179..265 CDD:214653 20/95 (21%)
Ig 187..257 CDD:299845 16/79 (20%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 20/82 (24%)
IGc2 38..111 CDD:197706 19/75 (25%)
IG_like 143..215 CDD:214653 19/80 (24%)
IGc2 145..209 CDD:197706 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.