DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and zig-8

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:273 Identity:67/273 - (24%)
Similarity:109/273 - (39%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPP 113
            ||...::.|...|:.|.:..|.|.|.|.......::|.|..|..:||....|:|.|.|:.| ...
 Worm    33 ERSRVENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQV-SKK 96

  Fly   114 GSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVI-----ADNDFQDLKTKKRFYDTKSAR 173
            .:..|.|.:..|:.:|||.|.|::|.:.....|:.|:|:     :.:..|...||  .....|..
 Worm    97 SANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSPSSLQKKSTK--LMANMSGD 159

  Fly   174 AKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETE------KTDVGT 232
            ..:|..|.....:|..:.          .|:|....:.::|:        :||      |.|.|.
 Worm   160 EVVLNCTVTSTDKDEEVL----------DVVWTRDGNTINFN--------DTEKYILKVKRDAGV 206

  Fly   233 TSRLM-LTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKV 296
            ....| :.:|::.|.|||.| .:....||..||:    ..|..|||::.     |...:|.|..:
 Worm   207 VIETMRIRKATMEDDGNYAC-EHSQQKASQIVHI----NKAEAQTSNSA-----TFPCSIFSISI 261

  Fly   297 LLYISSLMEHMYL 309
            .:|.      :||
 Worm   262 FMYF------LYL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 26/88 (30%)
IG_like 58..140 CDD:214653 25/81 (31%)
IG_like 179..265 CDD:214653 20/92 (22%)
Ig 187..257 CDD:299845 16/76 (21%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 24/79 (30%)
Ig 55..129 CDD:143165 22/74 (30%)
ig 158..229 CDD:278476 18/89 (20%)
IG_like 158..227 CDD:214653 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28597
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.