DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and ntm

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:317 Identity:72/317 - (22%)
Similarity:113/317 - (35%) Gaps:115/317 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFS-----VIHPPGSEDWD 119
            ||:....:.|||||.|.|:..| |:|:.:..:        .|||:.::|     |:.......:.
 Frog    45 NVTVRQGDSAILRCTVDNRVTR-VAWLNRSTI--------LYTGNDKWSIDPRVVLLANTKSQYS 100

  Fly   120 LKIDYAQPRDSGVYECQVNTE--PKIN-LAICLQV----------IADND--------------- 156
            ::|......|.|.|.|.|.|:  ||.: :.:.:||          ||.|:               
 Frog   101 IEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANGRPE 165

  Fly   157 ----FQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSV--------------------- 196
                ::.|..|.|.:.::....:|.|.|     |:.:....||.                     
 Frog   166 PVVNWRYLSPKARGFVSEDEYLEITGIT-----REQSGIYECSASNDVSAPDVRRVKLTVNYPPY 225

  Fly   197 -----NIHAP----SVIWYHGSSV--VDF----------DSLRGGISLETEKTDVGTTSRLMLTR 240
                 ||.||    .::....|:|  .||          ||.| |:.:|..:    |.||:....
 Frog   226 ILDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDSWR-GVKVENRE----TISRVTFLN 285

  Fly   241 ASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAM-------QTSSAIRIRAFTAMIT 290
            .|.:|.|||||:...          |.|...|::       .|||.:.....||.:|
 Frog   286 VSEQDYGNYTCMAKN----------LLGHSNASIILFELFQSTSSPLLQEESTAALT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 26/92 (28%)
IG_like 58..140 CDD:214653 23/84 (27%)
IG_like 179..265 CDD:214653 27/127 (21%)
Ig 187..257 CDD:299845 25/111 (23%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 26/96 (27%)
IG_like 45..133 CDD:214653 26/96 (27%)
IG_like 143..220 CDD:214653 12/81 (15%)
IGc2 150..209 CDD:197706 9/63 (14%)
ig 227..311 CDD:278476 26/98 (27%)
IG_like 230..311 CDD:214653 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.