DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and iglon5

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:220 Identity:47/220 - (21%)
Similarity:84/220 - (38%) Gaps:53/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSV-----IHPPGSEDWDLKIDYAQPR 128
            |.|.|.:.:|..| |:|:.:.::        .|.|..::|:     :......::.:.|.:....
 Frog    44 ATLSCLIDDKVTR-VAWLNRSNI--------LYAGKDKWSIDSRVQLLTNTKSEYSIVITHVDVA 99

  Fly   129 DSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILG-STEIHVKRDSTIAL 192
            |.|:|.|...||.|.:.:                  :.|......|||:. |:.:.|...|.:.|
 Frog   100 DEGLYTCSFQTEDKPHTS------------------QVYLIV
QVPAKIVNISSSVTVNEGSNVNL 146

  Fly   193 AC-SVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCV-PNG 255
            .| :|....|::.|         ..|..|.|.|.|        .|.:|..:.:.:|:|.|| .||
 Frog   147 QCLAVGKPEPTITW---------QQLSEGFSSEGE--------LLEITEINRQQAGDYECVTSNG 194

  Fly   256 -AIPASVRVHVLTGEQPAAMQTSSA 279
             ::|.:.:|.:.....|......:|
 Frog   195 VSVPDTKKVQITVNYPPYITDVKNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 18/80 (23%)
IG_like 58..140 CDD:214653 15/75 (20%)
IG_like 179..265 CDD:214653 23/88 (26%)
Ig 187..257 CDD:299845 19/72 (26%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 19/105 (18%)
IG_like 35..123 CDD:214653 19/105 (18%)
Ig 126..207 CDD:299845 26/97 (27%)
I-set 128..207 CDD:254352 25/95 (26%)
I-set 210..299 CDD:254352 2/10 (20%)
Ig 227..298 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.