DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:309 Identity:65/309 - (21%)
Similarity:103/309 - (33%) Gaps:101/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNK----------- 78
            :..::.|.:|...:.:|::.:  ...|.|.. .|.:.|.|:.|..:|.|.|.|.           
Zfish     1 MGFSMTCLWIVTLAIISVHRV--FSGPRFSQ-EPADQSVVIGERVVLSCVVFNYTGIVQWTKDGL 62

  Fly    79 ----GNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNT 139
                |....:|.|.|.|.|:....|                   :|:|..|...|..:||||. |
Zfish    63 ALGIGEDLRAWPRYRVLRIMDVGQY-------------------NLEITSADLTDDSLYECQA-T 107

  Fly   140 EPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAK-----------ILGSTEIHVKRDSTIALA 193
            |..:                          :|.|||           |.||.||.:...::..|.
Zfish   108 EAAL--------------------------RSRRAKLTVLIPPDGPVIEGSPEILLTAGTSFNLT 146

  Fly   194 CSVNIHAP--SVIWYHGSSVVDFDSLRGGISLETE----KTDVGTTSRLMLTRASLRDSGNYTCV 252
            |......|  ::.||....:|:      |....||    :..|.|.|.|.:.........|:|||
Zfish   147 CVSRGAKPMSTIEWYKDGIIVE------GAHTSTEVLSDRKRVTTKSFLEIQPMDTDTGRNFTCV 205

  Fly   253 -PNGAIP------ASVRVH----VLTGEQPAAMQTSSAIRIRAFTAMIT 290
             .|.|.|      .::.:|    |:...:|.::.....::   ||...|
Zfish   206 ASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVK---FTCQAT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 25/103 (24%)
IG_like 58..140 CDD:214653 23/96 (24%)
IG_like 179..265 CDD:214653 24/102 (24%)
Ig 187..257 CDD:299845 18/76 (24%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.