DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and tmigd1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001106530.1 Gene:tmigd1 / 100127721 XenbaseID:XB-GENE-877202 Length:266 Species:Xenopus tropicalis


Alignment Length:263 Identity:52/263 - (19%)
Similarity:94/263 - (35%) Gaps:71/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DISPRNVSAV----VDEIAILRCRV-KNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPG 114
            :::.:|||.|    :.|:|.|||.| .|..|..:.|               |.|.::..|.....
 Frog    35 ELNTKNVSHVMKLNISEMASLRCEVLDNTRNEELIW---------------YRGIRQVDVSKKNN 84

  Fly   115 SEDWDLKIDYAQPRDSGV-YECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKIL- 177
            .....:.|......|:|| :.|.:..:..:.|::.|.:             ||       ..|| 
 Frog    85 VNSSQVCIFPLSTEDNGVSFTCLLKRDNTVKLSVMLDI-------------RF-------PPILE 129

  Fly   178 GSTEIHVKRDSTIALACSVNIHAPS-VIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRA 241
            |.:.:.|:...:..|.|.|..:..: ::|.....||..:..|....|:::|      .:|.:.:.
 Frog   130 GESSVTVEVGKSAQLTCIVKANPQAEMVWKKNGVVVTMEKSRYRQYLDSDK------FQLNIDKV 188

  Fly   242 SLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQT----------SSAIRIRAFTAMITIISTKV 296
            ...|.|.||||.           |.|.:.....:|          ...:.:.|..|.: ::...|
 Frog   189 VETDGGIYTCVA-----------VATDDNTTTTETKMFELLVEGKKEVLPVEAIAAAV-VVGALV 241

  Fly   297 LLY 299
            :|:
 Frog   242 ILF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 21/94 (22%)
IG_like 58..140 CDD:214653 21/87 (24%)
IG_like 179..265 CDD:214653 17/86 (20%)
Ig 187..257 CDD:299845 16/70 (23%)
tmigd1NP_001106530.1 Ig_3 126..200 CDD:372822 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1099491at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.