DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and lsamp

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:280 Identity:59/280 - (21%)
Similarity:100/280 - (35%) Gaps:101/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSE----- 116
            |..|::....:.|||||.|:::.:| |:|:.:..:        .:.||.::|:  .|..|     
 Frog    37 STDNITVRQGDTAILRCFVEDRSSR-VAWLNRSGI--------IFAGDDKWSL--DPRVELEKRS 90

  Fly   117 --DWDLKIDYAQPRDSGVYECQVNTE---------------PKI-NLA----------ICLQVIA 153
              ::.|:|......|.|.|.|.|.|:               ||| |::          :.|..||
 Frog    91 LLEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKISNISADITVNEGSNVTLMCIA 155

  Fly   154 ------------------DNDFQDLKTKKRF-------------YDTKSARAKILGSTEIHVKR- 186
                              .:..:|.:.::.|             |:.|:|..  :.|.::...| 
 Frog   156 YGRPEPMITWRHLTPTAGTSPARDFEGEEEFLEIQGITREQSGRYECKAANE--VASADVKQVRV 218

  Fly   187 --------------DSTIA----LACSVN-IHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGT 232
                          ::|..    |.|..: :.||...||..    |..|.|...:...|..:.|:
 Frog   219 TVNYPPIITESKSNEATTGKQAILRCEASAVPAPDFEWYKD----DTRSRRINSAQGLEIRNTGS 279

  Fly   233 TSRLMLTRASLRDSGNYTCV 252
            .|.||:...:....||||||
 Frog   280 RSVLMVANVTEEHYGNYTCV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 27/110 (25%)
IG_like 58..140 CDD:214653 22/88 (25%)
IG_like 179..265 CDD:214653 23/94 (24%)
Ig 187..257 CDD:299845 21/71 (30%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 23/100 (23%)
FR1 38..54 CDD:409353 5/15 (33%)
Ig strand A' 39..45 CDD:409353 1/5 (20%)
Ig strand B 47..55 CDD:409353 5/7 (71%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 3/7 (43%)
Ig strand C 60..66 CDD:409353 3/6 (50%)
CDR2 68..78 CDD:409353 2/17 (12%)
Ig strand C' 70..73 CDD:409353 0/10 (0%)
Ig strand C' 75..78 CDD:409353 1/2 (50%)
FR3 79..114 CDD:409353 9/36 (25%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 0/8 (0%)
FR4 121..128 CDD:409353 0/6 (0%)
Ig_3 131..206 CDD:404760 11/74 (15%)
Ig strand A' 138..143 CDD:409353 0/4 (0%)
Ig strand B 149..156 CDD:409353 2/6 (33%)
Ig strand C 162..167 CDD:409353 0/4 (0%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 1/5 (20%)
Ig strand F 198..205 CDD:409353 2/6 (33%)
Ig strand G 212..220 CDD:409353 1/7 (14%)
Ig_3 223..302 CDD:404760 21/81 (26%)
putative Ig strand A 224..230 CDD:409353 0/5 (0%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/3 (67%)
Ig strand F 295..300 CDD:409353 5/5 (100%)
Ig strand G 308..311 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.