DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG34458

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:290 Identity:74/290 - (25%)
Similarity:126/290 - (43%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSG 84
            |..:|.|:.|:|..     |.:.:|......    .|::||..|.....|..|.:.......|.|
  Fly     4 VNNLVKLSILLLAV-----TFVHSDMDVAEE----SRIIGGQFAAPGQFPHQVSLQLNGRHHCGG 59

  Fly    85 SLITRLFVLTSASCLLSL-PKQV--ILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKY 146
            |||:...::|:|.|.:.. |.|:  |:|..|.:..:.      |..:|.|.|||.::..:: :.:
  Fly    60 SLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNG------QTFNIAQFIIHPRYNPQS-QDF 117

  Fly   147 DIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTA------TGWGTTEWN-EPSTILQTVTLS 204
            |::|::|:..|.:...|:.|      |:..|..::.|      :|:|....| :....|:...:.
  Fly   118 DMSLIKLSSPVPMGGAVQTI------QLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQ 176

  Fly   205 KINRKYCKGRLRQNIDASQLCVGGP--RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVS 267
            ..:|.||..:....:....:|.|.|  :..:|.||:||||::      |||        |.|:||
  Fly   177 LWSRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTV------DGK--------LFGVVS 227

  Fly   268 YGSSSCSGIG---VYTNVEHYMDWIVRTIN 294
            :| ..|...|   :||.|.....||.:..|
  Fly   228 WG-FGCGAKGRPAMYTYVGALRSWIKQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 64/247 (26%)
Tryp_SPc 57..292 CDD:238113 65/249 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 64/247 (26%)
Tryp_SPc 32..254 CDD:238113 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.