DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG9733

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:304 Identity:101/304 - (33%)
Similarity:147/304 - (48%) Gaps:66/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NDCGTTRHPSR---------------------IR-RVVGGNDADRFANPWMVMV-----LGEN-N 79
            |...|:|.|.|                     || |:..|.|.|....||||::     .|.. :
  Fly   126 NQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLS 190

  Fly    80 VFCSGSLITRLFVLTSASCLLSLPKQ-------VILGEYDRNCTSAD-------CTSIRQVIDID 130
            ..|:||||.|.:|||:|.||....::       |.|||:|.. |:.|       |:...|.:..:
  Fly   191 TACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTR-TAVDCPPGGGSCSPEVQRLGFE 254

  Fly   131 QKIIHGQFGLETVKK-YDIALLRLAKKVSISDYVRPICL--SVDRQVGRSVQHFTATGWGTTEWN 192
            :..:|.::..:...: :||.|:|:.:.|..||.::||||  ||..:..:|.|.||..|||.|...
  Fly   255 EIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKM 319

  Fly   193 EPSTILQTVTLSKINRKYCKGRLRQ---NIDASQLCVGGP-RKDTCSGDAGGPLSLTLKIDGDGK 253
            ..|.:.|.||::.::...|:.|..|   |::.:|||.||. |||:|.||:|||| :..:   |..
  Fly   320 ARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPL-MRFR---DES 380

  Fly   254 WNNKSRAFLIGIVSYGSSSCSGI----GVYTNVEHYMDWIVRTI 293
            |      .|.||||:| ..| |:    ||||||..|..||.:.:
  Fly   381 W------VLEGIVSFG-YKC-GLKDWPGVYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 92/263 (35%)
Tryp_SPc 57..292 CDD:238113 93/265 (35%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 92/263 (35%)
Tryp_SPc 162..415 CDD:238113 93/265 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.