DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and aqrs

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:237 Identity:62/237 - (26%)
Similarity:94/237 - (39%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQV-ILGEYDRNCTSADCTSIRQVIDIDQK- 132
            :.|.||.|.:|.|:|:||:|..|:||..|.  .|::. ::.||     :|...||...:::|.. 
  Fly    77 YYVNVLNEGSVICAGALISRRMVVTSTHCF--QPRRFDLIYEY-----TAKHLSILTGVELDDNP 134

  Fly   133 IIHGQFGL-------ETVKKYDIALLRLAKKVSISDYVRPICLSVDR-QVGRSVQHFTATGWGTT 189
            ..|...|.       |....| :|||.|:.|:....| |.|.|...: |.|..|:        ..
  Fly   135 EPHQVIGFFMPVNKNERFTNY-VALLALSNKLDRDKY-RYIPLHRKKPQAGDDVK--------MA 189

  Fly   190 EWNEPSTILQTVTLSKINRKYCKGR--LRQNIDASQ-----LCVGGPR---KDTCSGDAGGPLSL 244
            .:..|...::......::...||..  |::....|.     :||...|   |.|||...|.||.:
  Fly   190 YYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLI 254

  Fly   245 TLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVYTNVEHYM 286
                      :||    |..|..|| ..|......||::.|:
  Fly   255 ----------DNK----LAAINIYG-EHCDEDDDSTNMDIYL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 62/237 (26%)
Tryp_SPc 57..292 CDD:238113 62/237 (26%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 60/232 (26%)
Tryp_SPc 83..268 CDD:304450 55/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.