DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG11836

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:270 Identity:94/270 - (34%)
Similarity:137/270 - (50%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPK---Q 105
            |||.:....||   |||........|||..::.:....|.|||:|:.:||::|.|:..|.|   :
  Fly    87 DCGFSNEEIRI---VGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIR 148

  Fly   106 VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICL-- 168
            ||.|::|:..||......|.|..:   |.|..|..:|... |||||||.|.:|.|..::||||  
  Fly   149 VIFGDHDQEITSESQAIQRAVTAV---IKHKSFDPDTYNN-DIALLRLRKPISFSKIIKPICLPR 209

  Fly   169 -SVD--RQVGRSVQHFTATGWG-TTEWNEPSTILQTVTLSKINRKYCKGRLRQN--IDASQLCVG 227
             :.|  .::|      |..||| |:|..|..:|:..|.:..::...|:.:..::  |.:|.||.|
  Fly   210 YNYDPAGRIG------TVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG 268

  Fly   228 GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSC--SGI-GVYTNVEHYMDWI 289
            .|..|:|.||:||||.|          :|..:.|::||||:| ..|  .|. |||:.|..::.||
  Fly   269 RPSMDSCQGDSGGPLLL----------SNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWI 322

  Fly   290 VRTINKSNTE 299
                 |||.|
  Fly   323 -----KSNLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 83/246 (34%)
Tryp_SPc 57..292 CDD:238113 85/248 (34%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.