DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG7142

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:294 Identity:75/294 - (25%)
Similarity:134/294 - (45%) Gaps:38/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ASLVLGARLGSSTLLTNDCGTTRHPSR---IRRVVGGNDADRFANPWMV---MVLGENNV--FCS 83
            |:..:...|.:..||.|...|...|.:   .::.:...:|...:.|::|   |:..:..:  :|:
  Fly    47 AAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCA 111

  Fly    84 GSLITRLFVLTSASCLLSLPKQV-----ILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETV 143
            |::|...::||:|.| ||.|:.|     :.|.:|.:....:.::| |:..||..:.| :..|..|
  Fly   112 GTIINEHWILTAAHC-LSSPQAVENSVIVAGSHDIHDQKGEASNI-QMRHIDYYVRH-ELYLGGV 173

  Fly   144 KKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWG----TTEWNEPSTILQTVTLS 204
            ..|||||:...:.:....||:|..|  ..|..:...:.|..|||    |...|.|.. ||...:.
  Fly   174 NPYDIALIYTKEPLVFDTYVQPATL--PEQDAQPEGYGTLYGWGNVSMTAVPNYPHR-LQEANMP 235

  Fly   205 KINRKYCKGRLRQN---IDASQLCVGGPRK---DTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLI 263
            .::.:.|:..|.::   :..:.||. ||..   ..|:.|:||||     |....:.:.:....:|
  Fly   236 ILDMELCEQILARSGLPLHETNLCT-GPLTGGVSICTADSGGPL-----IQQCCEEHFEQANIVI 294

  Fly   264 GIVSYGSSSC---SGIGVYTNVEHYMDWIVRTIN 294
            ||||:|...|   :...|:..|..:.:||.:.|:
  Fly   295 GIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 65/255 (25%)
Tryp_SPc 57..292 CDD:238113 67/257 (26%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/253 (26%)
Tryp_SPc 84..323 CDD:214473 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.