DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG14892

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:412 Identity:96/412 - (23%)
Similarity:140/412 - (33%) Gaps:167/412 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMV------LGENNVFCSG 84
            |:.|.|...|.||.....||| .|...|..|::.|...:....||...:      ||....:|..
  Fly    51 LSWLCLLLLLPSSRQFETDCG-CRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGA 114

  Fly    85 SLITRLFVLTSASC----LLSLP----KQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLE 141
            .||.:.::|::|.|    |.:||    ..|:|||:||:..|.:    .|.|.:::.::|.::   
  Fly   115 VLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGN----EQRIPVEKIVMHHRY--- 172

  Fly   142 TVKKYDIALLRLAKKVSI--SDYVRPICL--------------------SVDRQV---------- 174
            ...|:|:.|::|:|...:  :..:|.|||                    |.|..|          
  Fly   173 HNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDV 237

  Fly   175 -------GRSVQ----------------------------------------------------- 179
                   .||||                                                     
  Fly   238 PEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPR 302

  Fly   180 ------------------------HFTATGWG--TTEWNEPSTILQT-VTLSKINRKYCKGRLRQ 217
                                    ...|||||  ....:..:.:|:| |.|.:      .||.|.
  Fly   303 RDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQ------NGRCRD 361

  Fly   218 ------NIDASQLCVG--GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCS 274
                  ||....||.|  .....||.||:||||.  .::..||.|      .|:|:.|:| |.|:
  Fly   362 AYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQ--CRLSRDGPW------ILVGVTSFG-SGCA 417

  Fly   275 GIG---VYTNVEHYMDWIVRTI 293
            ..|   |||...:||.||..||
  Fly   418 LEGFPDVYTRTSYYMKWIEDTI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 81/376 (22%)
Tryp_SPc 57..292 CDD:238113 82/378 (22%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 81/376 (22%)
Tryp_SPc 81..438 CDD:238113 82/378 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.