DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG3916

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:137/293 - (46%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGG---NDADRFANPWMVMVLGENNVFCSG 84
            ::.|..::|..|.|.:.::|:   ||..|:||.   ||   |:...|.....:...|....||.|
  Fly     3 VLQLFCMLLILRQGLADVVTS---TTESPTRIN---GGQRVNETVPFQVSLQMQRRGRWQHFCGG 61

  Fly    85 SLITRLFVLTSASCLLSLPKQ---VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKY 146
            |:::...|||:|.|:..:..:   |::|..:   ..|.....|.|    .|.:|.|:.:......
  Fly    62 SIVSGQHVLTAAHCMEKMKVEDVSVVVGTLN---WKAGGLRHRLV----TKHVHPQYSMNPRIIN 119

  Fly   147 DIALLRLAK--KVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTI-------LQTVT 202
            ||||:::..  ::..|| :..|.:....::|..|. ...||||:|   .|||.       ||.:.
  Fly   120 DIALVKVTPPFRLERSD-ISTILIGGSDRIGEKVP-VRLTGWGST---SPSTSSATLPDQLQALN 179

  Fly   203 LSKINRKYC--KG-RLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIG 264
            ...|:.:.|  || |:.:| :...|.|.|  :..|.||:||||.      ..||     :..|:|
  Fly   180 YRTISNEDCNQKGFRVTRN-EICALAVQG--QGACVGDSGGPLI------RPGK-----QPHLVG 230

  Fly   265 IVSYGSSSCS--GIGVYTNVEHYMDWIVRTINK 295
            |||||||:|:  ...|||.|..::.:|.:.||:
  Fly   231 IVSYGSSTCAQGRPDVYTRVSSFLPYISQVINQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 73/252 (29%)
Tryp_SPc 57..292 CDD:238113 74/254 (29%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 75/255 (29%)
Tryp_SPc 31..260 CDD:238113 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.