DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG4477

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:292 Identity:70/292 - (23%)
Similarity:108/292 - (36%) Gaps:91/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLS- 101
            |..|:|.|.:.|..|          |::|        .|:|: ||||.::..:||:|||.||:: 
  Fly    47 SIALSNYCVSLRSRS----------AEKF--------FGDNH-FCSGVILAPMFVMTSAHCLINK 92

  Fly   102 ----LPKQVIL---GEYDRNCTSADCTSIRQVIDI---DQKIIHGQ--FGLETVK------KYDI 148
                :..:|:|   |..:|.....:.|.:..|..|   |...:..:  |||..||      ...|
  Fly    93 RRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSFTMRNKQDFGLLKVKNPFPRNNEHI 157

  Fly   149 ALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEP-STILQTVTLSKINRKYCK 212
            ::.||.        |.|....:..:|         .|||......| ::.:..:.:..|:.:.|.
  Fly   158 SIARLP--------VHPPLPGLKCKV---------MGWGRMYKGGPLASYMLYIDVQVIDSEACA 205

  Fly   213 GRLRQ-------NIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGS 270
            ..||.       .:|:..|....|    |.||.|.|:              .....:.|||:.  
  Fly   206 KWLRVPSVEHVCAVDSDDLTAQQP----CGGDWGAPM--------------LHNGTVYGIVTI-- 250

  Fly   271 SSCSGIGV------YTNVEHYMDWIVRTINKS 296
              .:|.||      ||||....:||...|..|
  Fly   251 --LAGCGVSHLPSLYTNVHSNANWIHEKIISS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 60/265 (23%)
Tryp_SPc 57..292 CDD:238113 62/267 (23%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 64/278 (23%)
Tryp_SPc 55..273 CDD:214473 62/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.