DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG33465

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:295 Identity:86/295 - (29%)
Similarity:130/295 - (44%) Gaps:39/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSG 84
            ::.::.||.:.|....|.:.||...|    |..:....:..|.......|||..:...|...|.|
  Fly     1 MSRVLSLALIGLVLCQGLAQLLDKKC----HDPKTSENINFNHGATETAPWMASIYKNNQFICDG 61

  Fly    85 SLITRLFVLTSASCLLSLPKQ--VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKY- 146
            :|:.:|||||:||| :|...|  |:.|.|:            |..|..|...:.|:|:....:: 
  Fly    62 TLVHKLFVLTAASC-ISKDSQLYVLFGMYN------------QYRDASQFFNNEQYGVAVALQHS 113

  Fly   147 ---------DIALLRLAKKVSISDYVRPICLSVDRQV-GRSVQHFTATGWGTTEWNEPSTILQTV 201
                     ||.||||..:|:...::||||:.:|..| ....:.|...||........|.:.|||
  Fly   114 NFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTV 178

  Fly   202 TLSKINRKYC--KGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIG 264
            .||:.....|  .|:|.. |:..|.|.|...:..|..::|.||:      .|..:..|:....:|
  Fly   179 YLSQKKPFECHRNGQLLP-INEGQFCAGNRDRSFCRSNSGSPLT------ADFTYGVKNITVQVG 236

  Fly   265 IVSYGSSSCSGIGVYTNVEHYMDWIVRTINKSNTE 299
            :|||||..||...|||:|..:.|||..|:....|:
  Fly   237 LVSYGSELCSPTSVYTDVVAFKDWIYNTVRNFETK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 74/247 (30%)
Tryp_SPc 57..292 CDD:238113 76/249 (31%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 75/237 (32%)
Tryp_SPc 46..261 CDD:214473 73/234 (31%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.