powered by:
Protein Alignment CG33225 and pik3ip1
DIOPT Version :9
Sequence 1: | NP_001286682.1 |
Gene: | CG33225 / 2768860 |
FlyBaseID: | FBgn0053225 |
Length: | 307 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_938188.1 |
Gene: | pik3ip1 / 386643 |
ZFINID: | ZDB-GENE-031030-14 |
Length: | 263 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 15/75 - (20%) |
Similarity: | 27/75 - (36%) |
Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 CLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRK 231
|::.:.:..|..|..|::|.....|...:...:.......:..:|: |.| |..|
Zfish 25 CITNNGEDYRGTQQKTSSGSTCLSWRSLNLKFKDSQTGVGDHNFCR-----NPD-------GSNK 77
Fly 232 DTC--SGDAG 239
..| ||.:|
Zfish 78 PWCYVSGSSG 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170575892 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.