DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG14990

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:318 Identity:93/318 - (29%)
Similarity:136/318 - (42%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VNTYIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRH----PSRIRRVVGGNDADRFAN------ 68
            :||::.|:   .|.| ..|...|.:..:.|....|.:    |:::..:  .|.....||      
  Fly     7 INTFLLVS---FLCS-ATGQNEGGAPGIFNGMSFTENLQPDPNQVCGM--SNPNGLVANVKVPKD 65

  Fly    69 -------PWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVIL---GEYDRNCTSADCTS- 122
                   ||:|.:..:...|.:||||....|||:||.::......|:   ||::....|....| 
  Fly    66 YSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSE 130

  Fly   123 IRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSV--QHFTATG 185
            .|.|..:.|   |.:|.. .:...:||||.||....:..::|.|||.   ..|||.  :....||
  Fly   131 DRPVARVVQ---HREFSY-LLGANNIALLFLANPFELKSHIRTICLP---SQGRSFDQKRCLVTG 188

  Fly   186 WGTTEWNEP--STILQTVTLSKINRKYCKGRLRQ-------NIDASQLCVGGPRKDT--CSGDAG 239
            ||...:|:.  |.|.:.:.|..|||..|:.:||.       ::.||.:|.|| .||.  |.||.|
  Fly   189 WGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGG-EKDAGDCLGDGG 252

  Fly   240 GPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIG--------VYTNVEHYMDWI 289
            ..|...::.|       .||....|||::      |||        ||||||.:.|||
  Fly   253 SALFCPMEAD-------PSRYEQAGIVNW------GIGCQEENVPAVYTNVEMFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 81/270 (30%)
Tryp_SPc 57..292 CDD:238113 83/271 (31%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 80/252 (32%)
Tryp_SPc 67..297 CDD:214473 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.