DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG9294

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:290 Identity:89/290 - (30%)
Similarity:140/290 - (48%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSTLLTN-----DCGTTRHP--SRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLT 94
            |.|.:.|     ||.|.|..  :.:.::|||.:......|||.::|..|..:||||||..|:|||
  Fly    74 SRTTVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLT 138

  Fly    95 SASCLLSLPKQVI---LGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKK 156
            :|.|:..:|.::|   ..|::|:.::.|....|.|..:.   :|..:...:... |:|:|||.:.
  Fly   139 AAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVK---VHELYNPRSFDN-DLAVLRLNQP 199

  Fly   157 VSISDY-VRPICL-----SVDRQVGRSVQHFTATGWGT-TEWNEPSTILQTVTLSKINRKYCK-- 212
            :.:..: :|||||     |.|.::|      ...|||. .|....:..|:.|.:..:.:..|:  
  Fly   200 LDMRHHRLRPICLPVQSYSFDHELG------IVAGWGAQREGGFGTDTLREVDVVVLPQSECRNG 258

  Fly   213 -----GRLRQN-IDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSS 271
                 |::..| :.|..:..||  ||.||||:||||..|.. :..|::.      |.||||:| .
  Fly   259 TTYRPGQITDNMMCAGYISEGG--KDACSGDSGGPLQTTFD-EQPGQYQ------LAGIVSWG-V 313

  Fly   272 SCS---GIGVYTNVEHYMDWIVRTINKSNT 298
            .|:   ..||||.|..|:.|:     .|||
  Fly   314 GCARPQSPGVYTRVNQYLRWL-----GSNT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 78/253 (31%)
Tryp_SPc 57..292 CDD:238113 79/255 (31%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/252 (31%)
Tryp_SPc 101..334 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.