DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG10764

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:286 Identity:95/286 - (33%)
Similarity:149/286 - (52%) Gaps:32/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LASLVLGARLGSSTL----------LTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNV 80
            :.|||..|.|...||          |...||.:..|    ::.||:||....:.||..:...::.
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGISTRP----KISGGDDAAEPNSIWMAAIFNSSDF 61

  Fly    81 FCSGSLITRLFVLTSASCLL-SLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVK 144
            .|.|::|...|||::|.||: .....|.||..:.|    :..::..||::   .:|..| :.:..
  Fly    62 QCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNIN----EPAAVHTVINV---FVHHDF-IASEY 118

  Fly   145 KYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQH---FTATGWGTTEWNEPSTILQTVTLSKI 206
            :.||.||:|::.:..:..|:|||:.:|..:..||:.   |.|.|||... .:.|.:|||:.|..:
  Fly   119 RNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN-GKLSIMLQTIYLLHL 182

  Fly   207 NRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSS 271
            .|..||.:|..|:::.|:|.|....|||.||:|||||..:...     :|||....:||||:|..
  Fly   183 KRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFP-----SNKSYEVQLGIVSFGDP 242

  Fly   272 SCSGIGVYTNVEHYMDWIVRTINKSN 297
            .|.|:||||:|..|:|||..||.:::
  Fly   243 ECRGVGVYTDVTSYVDWISSTIARND 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 80/236 (34%)
Tryp_SPc 57..292 CDD:238113 82/238 (34%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 80/236 (34%)
Tryp_SPc 38..263 CDD:238113 82/238 (34%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.