DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:277 Identity:90/277 - (32%)
Similarity:130/277 - (46%) Gaps:37/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSTLLTNDCGTTR--HPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCL 99
            ||..|...||...  .|.: .|:|||.:|.....||:.::......||.|||||...:||:|.|:
  Fly   379 SSEGLPLQCGNKNPVTPDQ-ERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCV 442

  Fly   100 LSLPKQVI------LGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVS 158
            ..:....:      ||:|:.. |..:...:.:  .|.:.:.|..|...|:.. |:|:|.|::.|.
  Fly   443 ARMTSWDVAALTAHLGDYNIG-TDFEVQHVSR--RIKRLVRHKGFEFSTLHN-DVAILTLSEPVP 503

  Fly   159 ISDYVRPICLSVD-RQVGRSV--QHFTATGWGTTEWNEPS-TILQTV-----TLSKINRKYCKGR 214
            .:..::||||... .|..||.  |..|..|||:...|.|. :|||.|     |.::..|||  ||
  Fly   504 FTREIQPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECARKY--GR 566

  Fly   215 LRQ-NIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG--I 276
            ... .|..|.:|.|...||:||||:|||:.:          |:..|...:||||:|.....|  .
  Fly   567 AAPGGIIESMICAGQAAKDSCSGDSGGPMVI----------NDGGRYTQVGIVSWGIGCGKGQYP 621

  Fly   277 GVYTNVEHYMDWIVRTI 293
            ||||.|...:.||.:.|
  Fly   622 GVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 81/250 (32%)
Tryp_SPc 57..292 CDD:238113 82/252 (33%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 81/250 (32%)
Tryp_SPc 400..637 CDD:238113 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.