DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG40160

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:118/254 - (46%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGGNDADRFANPWMVMVLGENNV--FCSGSLITRLFVLTSASCLLSLPK---QVILGEYDRNCTS 117
            |..|:|.....||.|.:|...|:  ||:||||.:..|||:|.|:.||..   .|..||:|..   
  Fly   166 VSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQ--- 227

  Fly   118 ADCTSIRQVIDIDQK-----IIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRS 177
                ::::.:...::     |:|..:...:: .||.||:.|::.|::.|::..|||.....:.:.
  Fly   228 ----TMKERLPYQERSVQTVILHPDYNRRSI-AYDFALVILSQPVTLDDHINVICLPQQDDIPQP 287

  Fly   178 VQHFTATGWGTTEW---NEPSTILQTVTLSKINRKYCKGRLRQN-------IDASQLCVGGPRK- 231
            .....:||||...:   .:.|::::.|.|..:....|:.|||..       :|.|.:|.||.|. 
  Fly   288 GNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGI 352

  Fly   232 DTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGI-GVYTNVEHYMDWI 289
            |||.||.|.||:..     .|. ..:||....|||::|......: ..|.||.....||
  Fly   353 DTCQGDGGAPLACP-----RGS-TRESRYQQTGIVAWGIGCNDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 72/252 (29%)
Tryp_SPc 57..292 CDD:238113 74/254 (29%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 74/254 (29%)
Tryp_SPc 169..405 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.