DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and ctrb.1

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:278 Identity:88/278 - (31%)
Similarity:127/278 - (45%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VLLASLVLGARLGSSTLLTNDCGTTRHPSRI---RRVVGGNDADRFANPWMVMVLGENNV-FCSG 84
            :|......||..|        ||....|..:   .|:|.|.:|...:.||.|.:...... ||.|
Zfish     6 ILSCLAFFGAAYG--------CGIPAIPPVVTGYARIVNGEEARPHSWPWQVSLQDSTGFHFCGG 62

  Fly    85 SLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIA 149
            |||...:|:|:|.|.:....:|||||:||   |::..:| |.|.:.:.|.|..:...|:.. ||.
Zfish    63 SLINENWVVTAAHCNVRTSHRVILGEHDR---SSNAEAI-QTIAVGKSIKHPNYNSFTINN-DIL 122

  Fly   150 LLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPST--ILQTVTLSKINRKYCK 212
            |::||....|:.:|.|:||:..............:|||.|.:|.|.|  :||...|..:....||
Zfish   123 LIKLATPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTRYNAPDTPALLQQAALPLLTNDDCK 187

  Fly   213 GRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGI- 276
            .....||....:|.|.....:|.||:|||    |..:.:..|.      |:||||:|||:||.. 
Zfish   188 RYWGTNITDLMICAGASGVSSCMGDSGGP----LVCENNRVWT------LVGIVSWGSSTCSTST 242

  Fly   277 -GVYTNVEHYMDWIVRTI 293
             .||..|.....|:.:||
Zfish   243 PAVYARVTKLRAWVDQTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 78/237 (33%)
Tryp_SPc 57..292 CDD:238113 78/239 (33%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 78/237 (33%)
Tryp_SPc 34..259 CDD:238113 78/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.